PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009628186.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 220aa    MW: 25315.8 Da    PI: 6.7079
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009628186.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY89.62.6e-28133191159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYG+K+vk++++pr+YY+C+s  C+vkkkver+ +d +++++tYeg+Hnhe
  XP_009628186.1 133 LDDGYKWRKYGKKKVKSNTNPRNYYKCSSGCCKVKKKVERDGNDSSYLITTYEGKHNHE 191
                     59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.0E-30119193IPR003657WRKY domain
SuperFamilySSF1182901.44E-25126193IPR003657WRKY domain
PROSITE profilePS5081129.482128193IPR003657WRKY domain
SMARTSM007744.2E-29133192IPR003657WRKY domain
PfamPF031067.4E-22134191IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MFGSSTFQET INISHQTINP NFAFSPLINM NQDHCHNMYQ DFDTSFIDQL INDSEEYSNS  60
NNSFNTSLYS QNPFMQQEIS TSTYSGSCSS ASSFDATPTN IHMNENSSKG IEKEKKAEKH  120
AIAFRTKTEL EILDDGYKWR KYGKKKVKSN TNPRNYYKCS SGCCKVKKKV ERDGNDSSYL  180
ITTYEGKHNH ESPFIIYCQE KSTVSFHNDQ WSLQLADSLW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-24123193777Probable WRKY transcription factor 4
2lex_A2e-24123193777Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4604750.0DQ460475.1 Nicotiana tabacum cultivar Samsun NN putative WRKY transcription factor (WRKY12) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009628186.11e-165PREDICTED: probable WRKY transcription factor 51
RefseqXP_016464274.11e-165PREDICTED: probable WRKY transcription factor 51
TrEMBLQ1KRL71e-165Q1KRL7_TOBAC; Putative WRKY transcription factor
STRINGSolyc04g072070.2.17e-92(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA134941217
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.19e-15WRKY DNA-binding protein 51